Support Your Freedom to Speak:
Ska Brewing Modus Mandarina IPA 3.5/5
0 views
channel image
Beer and Gear
Published 3 months ago |
Today #drinkalongwithbeerandgear selection is from Ska Brewing out of Durango Colorado. We've had some of their other brews here on the channel and I figured they might be more accessible to you folks for the drink along.
Modus Mandarina runs 6.8 for the ABVs, the IBUs are 65 and the BME/SRM is 45.
On the nose she is piney, not picking up much of the citrus but she has an odd perfumey note on the end. Initial hit is thin and bitter, oily but not brutal to the palate. Medium fast thru the middle with the flavor profile centered around the mid mouth. Oddly she cleans up on the back, the oily residue is still clinging but the rest of the profile is gone. Weird.
Thanks for coming by and sharing a brewski w Pima, Sancho and I.
Be the Big 3 friends.
Skal !
E.
As always I have no connection to any of these companies. All opinions are my own
https://www.bitchute.com/channel/beerandgear
https://www.brighteon.com/channel/huhwhtfkr
https://www.minds.com/huhwhtfkr/
https://www.gab.com/huhwhtfkr
https://parler.com/BeerandGear/
https://twitter.com/BeerandGear1
https://www.subscribestar.com/huhwhtfkr
https://www.cocoscope.com/channel?i=6...
https://lbry.tv/$/invite/@beerandgear:d
https://www.joshwhotv.com/channel/Huhwhtfkr
Keywords
beerbeerandgearbeer-reviewbrewsandviewsipametricfridayska-brewing

FREE email alerts of the most important BANNED videos in the world

Get FREE email alerts of the most important BANNED videos in the world that are usually blacklisted by YouTube, Facebook, Google, Twitter and Vimeo. Watch documentaries the techno-fascists don't want you to know even exist. Join the free Brighteon email newsletter. Unsubscribe at any time. 100% privacy protected.

Your privacy is protected. Subscription confirmation required.

The views and opinions expressed in this video do not necessarily represent the views of Brighteon or its affiliates.
Related videos