The Most Efficient Nutrition Delivery System on the Planet
59 views
•
Published 4 years ago
•
If ever you have thought "What would be the BEST WAY to Get The Most out of the Foods I buy" then this is the Video for you.
Ripe Crops - Gently Processed WITHOUT Heat AT THE FARM - Living Enzyme Powders Delivered to Blending Facility - Directly Shipped to Consumer for MAXIMUM NUTRITIONAL DELIVERY compared to the inefficient and wasteful Standard American Food Supply Chain that provides a fraction of the nutrients at far higher prices.
Learn more about Purium at http://bit.ly/2BJR5wN
Use Code: wmburke to Save $50 or 25% whichever is more at ishoppurium.com or to Open Your Own Superfoods Super Store at puriumenrollment.com for as little as $0.
Book an Appointment for ANY of our Consulting Services with Designed to THRIVE Founder Professor William Burke at http://bit.ly/DtTBook
Ripe Crops - Gently Processed WITHOUT Heat AT THE FARM - Living Enzyme Powders Delivered to Blending Facility - Directly Shipped to Consumer for MAXIMUM NUTRITIONAL DELIVERY compared to the inefficient and wasteful Standard American Food Supply Chain that provides a fraction of the nutrients at far higher prices.
Learn more about Purium at http://bit.ly/2BJR5wN
Use Code: wmburke to Save $50 or 25% whichever is more at ishoppurium.com or to Open Your Own Superfoods Super Store at puriumenrollment.com for as little as $0.
Book an Appointment for ANY of our Consulting Services with Designed to THRIVE Founder Professor William Burke at http://bit.ly/DtTBook
Keywords
healthnutritionfoodhealingmedicinerecipesuperfoodsnaturalnutrientswellnesshealthysolutionstransformationnaturopathrestoredthrivesimplevitalitysimplifiedtransformed
FREE email alerts of the most important BANNED videos in the world
Get FREE email alerts of the most important BANNED videos in the world that are usually blacklisted by YouTube, Facebook, Google, Twitter and Vimeo. Watch documentaries the techno-fascists don't want you to know even exist. Join the free Brighteon email newsletter. Unsubscribe at any time. 100% privacy protected.
Your privacy is protected. Subscription confirmation required.
Related videos