Kefir 1 Ingredients to make GcMAF, how to avoid cancer, Green Machine Drink
271 views
•
Published 3 years ago
•
JourneyOfAdam
-How to make kefir from scratch.
-kefir is Lactose-free desert, the kefir eat up all the lactose in the milk.
-gluten free
Ingredients
Raw Milk (unadalterated)
Garden of Life Probiotic 400bil Raw IU
Douglas Labratories Collostrum
Yogurt Starter
For every 1 qt of RAW milk:
2 teaspoons of probiotic
1 Tablespoon of collostrum
1 packet of yogurt starter
Preparing onstructions in video.
Do NOT use metal of any kind.
Use plastic, glass, ceramic, or wood
Utincels, containers, and strainers.
Do NOT use store-bought milk.
Do NOT use almond, cashew, soy or any other replacement milk.
Goat milk is ok if its RAW.
Watch kefir 2 and 3 because you re-use the kefir grains, all you need to make kefir.
Thanks for watching.
Ingredients to make active Macrophages from Gc protein to activate your immune system.
Do NOT use store bought milk. It wont work period, because the milk has been denatured and pasteurized which destroys the active ingredients needed.
-Do not use Soy, almond, cashew milk, it will NOT work.
-Kefir makes the milk lactose-free.
-Do not use any metals; spoons, strainers, containers, etc.
-If you fail any of these steps, your not going to get GcMAF.
-Ingredients and how, and places to get ingredients are in video. So have a notepad and pen ready.
-How to make kefir from scratch.
-kefir is Lactose-free desert, the kefir eat up all the lactose in the milk.
-gluten free
Ingredients
Raw Milk (unadalterated)
Garden of Life Probiotic 400bil Raw IU
Douglas Labratories Collostrum
Yogurt Starter
For every 1 qt of RAW milk:
2 teaspoons of probiotic
1 Tablespoon of collostrum
1 packet of yogurt starter
Preparing onstructions in video.
Do NOT use metal of any kind.
Use plastic, glass, ceramic, or wood
Utincels, containers, and strainers.
Do NOT use store-bought milk.
Do NOT use almond, cashew, soy or any other replacement milk.
Goat milk is ok if its RAW.
Watch kefir 2 and 3 because you re-use the kefir grains, all you need to make kefir.
Thanks for watching.
Ingredients to make active Macrophages from Gc protein to activate your immune system.
Do NOT use store bought milk. It wont work period, because the milk has been denatured and pasteurized which destroys the active ingredients needed.
-Do not use Soy, almond, cashew milk, it will NOT work.
-Kefir makes the milk lactose-free.
-Do not use any metals; spoons, strainers, containers, etc.
-If you fail any of these steps, your not going to get GcMAF.
-Ingredients and how, and places to get ingredients are in video. So have a notepad and pen ready.
Keywords
healthfoodgreengcmafculturemedicalmachinetyrannyfreekafirmilkgrassrangevitaminkefirprobioticdyogurtkcolostrumjoa
FREE email alerts of the most important BANNED videos in the world
Get FREE email alerts of the most important BANNED videos in the world that are usually blacklisted by YouTube, Facebook, Google, Twitter and Vimeo. Watch documentaries the techno-fascists don't want you to know even exist. Join the free Brighteon email newsletter. Unsubscribe at any time. 100% privacy protected.
Your privacy is protected. Subscription confirmation required.
Related videos