Support Your Freedom to Speak:
Live UFO chat with Paul --054- Skinwalker Ranch (Finale Ep10) Portal Proof or just More Disinfo+more
channel image
TheOutThereChannel
58 Subscribers
37 views
Published 2 years ago

#UAP #UAPS #offworldcraft #alien #aliens #fraudchannels #UFOLOGY #AfieldofLies #misinformation #disinformation Topics with Chapters (TimeStamps) (0) complete after the show! its Live unscripted! (rough time locations) [00:00:00] (1) Gen Chat and wait for people to join the live show [00:06:10] (2) Google wrongful copyright and control of 5 year old videoa of mine using PD sounds and NZ Anthems. [00:20:32] (3) Main Topic = Skinwalker Ranch Finale revelations or BS [01:07:00] (4) GUFON doesnt understand basic science and gravitational lensing, Einstein space time and bent light. James Web Telescope JWST. [01:22:00] (5) Re-cap and research material the counter claims big bang spacetime gravity waves LIGO red/blue shift electric universe plasma eletromagnet universe and more. google suppressing wrongly PHDs who oppose or question the main strean narrative - ie cant find in a search. [02:49:00] (6) Dorothy Izatt Nonsense. recap my breakdown on her images, then a quick look over ufoofinterest and frauds thirdphaseofmoon congress man interview and what I dont like about it. Paul wraps up for the day. Thanks for watching, Liking, and commenting on video it really helps.. and join our serious UFO research group on Discord social text chat and optional voice group see join link in the about tab or banner bar and here as well, (https://discordapp.com/invite/D3s3SPr) A new How-To Tutorial on Discord and Group layout is now HERE! (https://youtu.be/LmOPdnOQ7Xs) cheers Paul. Thanks for watching, Liking, and commenting on video it really helps.. and join our serious UFO research group on Discord social text chat and optional voice group see join link in the about tab or banner bar and here as well, (https://discordapp.com/invite/D3s3SPr) A new How-To Tutorial on Discord and Group layout is now HERE! (https://youtu.be/LmOPdnOQ7Xs) cheers Paul. All Links can be found here to socials and beyond! https://linktr.ee/totclinks our website is listed there theouttherechannel.wordpress.com *** If you want to support my work with a donation as low as $1 a month then thanks very much *** Find all ways to donate here including monthly options That do NOT take 30 percent of the donation like google does! https://theouttherechannel.wordpress.com Purchase my Tshirt Designs and Other Merc Here ( I Earn from $3 to $5 per Item which goes towards production costs) https://shop.spreadshirt.com/TheOutThereChannel/ Thanks to the Following Paul S. (Music) Free Music Archive (creative commons music) Lobo_Loco_-_01_-_Technomagus_City_ID_501.mp3 sometimes other tunes or a mix of 2 Elvis_Herod_-_07_-_Eggs_Toast_Gas_Fish.mp3 Marc_Burt_-_04_-_Elements_Psychadelik_Pedestrian_chillout_edit. ALL footage used is either done under the express permission of the original owner, or is public domain and falls under rules of Fair Use. We are making such material available for the purposes of criticism, comment, review and news reporting

Keywords
aliensufoportalufos3dimagingparanormalbrandonimagesranchtravisskywalkerscapefugal

FREE email alerts of the most important BANNED videos in the world

Get FREE email alerts of the most important BANNED videos in the world that are usually blacklisted by YouTube, Facebook, Google, Twitter and Vimeo. Watch documentaries the techno-fascists don't want you to know even exist. Join the free Brighteon email newsletter. Unsubscribe at any time. 100% privacy protected.

Your privacy is protected. Subscription confirmation required.